
Problemet med kaldte gulv i første etasje - oppvarming nødvendigvis

Oppvarming av betonggulvet er svært viktig for å skape komfort og varme i huset, spesielt hvis leiligheten ligger i første etasje.

Men tregulv trenger også oppvarming.

For eksempel, i et privat hjem, uansett hvor godt belegget er laget, gir det ikke en full garanti for varmevern, og det vil derfor ikke være mulig å spare på oppvarming.

Hvorfor er det nødvendig å isolere gulvet?

Systemet varmeveksling av et hus eller leilighet er i stor grad avhengig av kjønnene, siden de er stedet for et stort varmetap.

Betong er slitesterkt og har utmerket ytelse, er populært for gulvbelegg, men det har en alvorlig ulempe - materialet er veldig kaldt. Hvis det er arrangert i en boligbygging, er det nødvendig med en kvalitativ termisk isolasjon, ellers vil ingen oppvarming være effektiv.

I tillegg, når det ikke er noen isolasjon og vanntetting av gulvet i den flate første etasje ligger vanligvis over uoppvarmet kjeller kan dannes damp, og som en konsekvens, formveggene.

Alt dette kan unngås, med en kvalitetsenhet av en termisk isolasjon.

Arbeidet med isolasjon av gulvet er ikke umulig. Hvis du har de nødvendige materialene og verktøyene, kan en eier håndtere det selvstendig.

Hva slags isolasjon er bedre å velge?

Det finnes flere typer isolasjon, produsert i form av blokker, bulkmaterialer, ruller og til og med i flytende form. Hver av dem er ganske egnet for oppvarming av det kalde gulvet i første etasje.

Matter og tallerkener

Varmere av denne typen har lav varmeledningsevne og lav vekt, de er best egnet for isolasjon av betonggulvet i første etasje.

De kan brukes sammen med tynne rullematerialer, noe som øker den samlede termiske isolasjonen.

Varmeelementer i form av matter og plater er laget av skum, mineralull, basaltfiber, basert på utvidet polystyren og andre komposittmaterialer.

Lange siden, for oppvarming av gulvene i private hus, ble mat brukt av vegetabilske fibre, for eksempel fra halm, som er en utmerket miljøvennlig isolasjon. Det eneste negative - det organiske er degradert over tid.

Løse ovner

For å miste materialer er det mulig å bære keramik som et varmeapparat av et gulv, sagsmør, en krummet av en styrofoam, en slagge og andre.

De brukes til oppvarming av gulv i leiligheter i første etasje, samt i private hjem.

Dette materialet er egnet både for å plassere på friluftsområdet under gulvet i et privat hus, og i leiligheter med uoppvarmet kjeller under.

Rullende materialer

Skummet polystyren, mineralull, kork eller kompositt på basis av korkmatter, flerlagsfolieisolasjon og andre er tilgjengelige i form av ruller.

Noen av dem har en liten tykkelse, og kan derfor ikke klare seg fullt ut med å opprettholde varmen - de er godt brukt i tillegg til tykkere varmeovner.

Vals mineralull, tykkelse på 7-10 cm er en utmerket termisk isolator, så det er ganske egnet for isolasjon.


Som flytende isolasjonsmaterialer brukes sementmørtel blandet med skumflis, flis, ekspandert leire og andre lette luftmaterialer.

En moderne versjon av væskeisoleringen - en polymer med en skumstruktur - penoizol. For å jobbe med det, brukes spesielt utstyr, med hvilket materialet er fylt med hulrom mellom skinnene på kassen.

Hvordan skikkelig isolere betonggulvet?

Ved beregning av isolasjon av gulv, er det nødvendig å ta hensyn til den betydelige belastningen som alle lag av strukturen vil gjennomgå.

For ulike typer gulvisolasjonsmateriale er noe forskjellig fra hverandre, men felles for alle gulvisoleringssystemer er å legge materialer i denne rekkefølgen:

  1. Basen er en betongplate.
  2. Et lag av vanntetting.
  3. Tre kasse.
  4. Varmeapparat, lagt mellom skinner
  5. Dampisolasjonsfilm (arkene er lappet 15-25 cm bred og limt med spesialtape).
  6. Hvis varmeren har en tykkelse på kassen, blir det lagt en motkrukke til den, noe som vil skape et mellomrom mellom varmeapparatet og det grove gulvet, noe som gir mulighet for ventilasjon.
  7. Grovt gulv (tykk kryssfiner eller brett).
  8. I tillegg kan under røggulvet benyttes rulle tynn isolasjon, som er spredt over kassen.

Metoden for oppvarming av kjønnene er lett å forstå ved å ta i betraktning den ovennevnte grafiske ordningen.

Funksjoner av isolasjon av betonggulv i første etasje i et privat hus og leilighet

Oppvarming av betonggulv i et privat hus og leilighet, avviker i noen nyanser, men prinsippet om oppvarming er i utgangspunktet det samme.

Hvis betonggulvene i et privat hus er isolert, som ikke har en kjeller under det, må flere materialer brukes.

Tykkelsen på isolasjonen er selvsagt bedre å beregne på forhånd, når man bygger et hus, men hvis isolasjonen allerede er utført i det ferdige rommet, er det nødvendig å forberede basen. Det samme gjøres i leiligheten:

  1. For dette blir et dekorativt belegg fjernet og en grundig revisjon av betongplaten utføres for sprekker og flis.
  2. Platen rengjøres, og alle defekter som oppdages, elimineres med en betong eller ferdig reparasjonsmørtel.
  3. Etter herdingen er det tilrådelig å behandle overflaten med en forsterkende impregnering - søling.
  4. Deretter kommer installasjonen av vanntetting - denne prosessen er viktig for både gulvet i første etasje av leiligheten og det private huset.

Vanntettende lag kan bestå av polyetylen-film, som må være på veggene 15-20 cm, eller påføres på gulv og vegger i den nedre del av en spesiell vannavstøtende strøk med dyp gjennomtrengning.

Hvis leiligheten lathing (logger) kan legges umiddelbart på vanntett, så i et privat hus er det bedre å heve det med 5-7 cm.

For å gjøre dette legger du tverrstykkene 5x5x15 cm for vanntettingen, der det er nødvendig å legge små stykker takmateriale.

  1. På logger stabler lags og fikser hele strukturen til betongbasen.
  2. Videre, et lag på 12-15 cm, kan du legge en løs isolasjon, for eksempel utvidet leire i tørr form eller ved tilsetning av en flytende sementmørtel. I sistnevnte tilfelle, etter at plassen er fylt, vent til laget er hardt.
  3. På toppen av det legger du plater eller en rulleversjon av mineralull, som har lav varmeledningsevne, og er den ideelle isoleringen av gulvene for både et privat hus og en leilighet. I tillegg er det mulig å bruke skumplast eller væskeisolasjon - penoizol.
  4. Isolasjonens topplag må være under lagets nivå med ca 5 mm.
  5. Mineral bomullsull er dekket med en dampbarrierefilm, som er festet til lags ved hjelp av stifter.
  6. Den siste fasen av oppvarming er den robuste gulvets enhet, som kan bestå av brett eller tykk kryssfiner. Dette vil avhenge av valg av overflaten.

Det er verdt å merke seg at hvis du planlegger å legge keramiske fliser på et tregulv, kan roughingen bestå av to lag: brett og kryssfiner.

Hvor best å isolere tregulvet i første etasje

Tregulv i moderne fler-etasjes hus passer ikke, men de finnes ofte i gamle bygninger og i privat sektor.

Træret i seg selv er et varmt materiale, men det har en egenartet sprekkdannelse over tid, som et resultat av hvilke sprekker blir dannet i gulvet, hvorved utkast trenger inn i leiligheten eller huset.

Slike gulv krever isolasjonsarbeid:

  • For å gjøre dette, er det nødvendig å heve eksisterende gamle dekk. Hvis den er i god stand, kan den etter oppvarmingsprosessen installeres tilbake.
  • Etter at brettene er fjernet, blir loggene inspisert og om nødvendig byttet ut med nye. Deretter behandles de med antiseptiske antifungale midler, og tiden for tørking er gitt.
  • På gulvets underlag legges eller helles isolasjon.

Ved bygging av et hus er tregulv bedre å isolere umiddelbart og observere alle teknologiske regler. Ordningen viser tydelig lagene av isolert tregulv, som går i denne rekkefølgen:

  1. Grunnlaget for huset.
  2. Stråler overlapper (logger).
  3. En bar for et tøft gulv.
  4. Dampisolasjon.
  5. Rå gulvet.
  6. Isolasjon.
  7. På toppen av det en vanntett film.
  8. Gulvplank.

Oppvarming fra kjelleren

Hvis leiligheten ligger over kjelleren, er det mulig å isolere gulvet fra hans side.

På taket av kjelleren under leiligheten kan du styrke isolasjonen.

For denne fremgangsmåten er skum, skumskum eller mineralull egnet.

  • Skum limes på taket i kjelleren med et spesielt lim. Etter at det tørker, er alle sprekker mellom platene lukket med et monteringsskum.

Ved hjelp av mineralull kan du også varme gulvene fra kjelleren, men det blir vanskeligere og dyrt.

  • Til taket er stengene festet til minivatbredden minus 5 cm. Dette er nødvendig for at isolasjonsmatter mellom dem skal passe tett.
  • For å holde isolasjonen trygt forsterkes en fiberplate eller tynn kryssfinér på toppen av den på tømmerblokker. På kanten av strukturen, langs veggene, er alle de dannede spaltene festet med skum.


For å arbeide med isolasjonen var effektiv, må du vite noen nyanser som det ønskede resultatet vil avhenge av.

  1. Det første du må gjøre, med gulvisolering i leiligheten i første etasje - er å inspisere veggene i kjelleren.

Hvis det finnes sprekker, sjetonger og muligens jevne åpninger på dem, må de være forseglet med sementbaserte løsninger, med monteringsskum eller om nødvendig med murverk.

Kvalitetsventilasjonshull til vinter kan dekkes, men de kan ikke lukkes helt.

  1. Hvis isolasjon skjer i et privat hus, der det er en kjeller, bør du i tillegg isolere gulvet og fra utsiden, dvs. Fest isolasjonen til kjellerens tak.
  2. Det er nødvendig å vite at høye varmeisolasjonsegenskaper har et lavdensitetsskum på grunn av sin porøse luftstruktur.
  3. Ikke glem å installere dampspjeldet, som må installeres riktig, og må limene festes med spesialtape.
  4. Ikke dekk hullene helt, ellers under gulvbelegg eller på varmeren selv, kan det danne kondens.

Hvis leiligheten din ligger i første etasje, trenger du ikke å utsette arbeidet på gulvets isolasjon. Før eller senere kommer det kaldt og fuktig å bosette seg i rommet, og sammen med dem - vil sopp og mugg vises på veggene i lokalene, og det vil være svært vanskelig å kvitte seg med dem.

Oppvarming av første etasje

De første etasjene i både flerfamilieboliger og private hjem kan være plassert over uoppvarmede rom, og i noen tilfeller, like over bakken i underfeltet. På grunn av dette, i lys av det harde klimaet i de fleste regionene i vårt land, står mange eiere overfor gulvvarme i første etasje. Hvis du ikke gjør slikt arbeid, vil du ikke føle deg komfortabel, fordi det er tvilsomt å gå på kaldt gulv i filt støvler eller varme tøfler.

Brukes for isolasjonsmaterialer

Ordningen med isolert gulv i første etasje

Etasje i første etasje

For tiden er det i byggemarkedet et stort utvalg av isolasjonsmaterialer som er egnet for isolasjon av de første etasjene i bygninger.

  • Mineralull - dette materialet består av fine tråder av et mineralstoff, hvorav luftplaster er. Luft er en god varmeisolator og dekker på en pålitelig måte varmenes lekkasje.
  • Utvidet polystyren - i dette materialet er luftbobler innkapslet i polymermaterialer.
  • Claydite - denne isolasjonen er de samme luftboblene, men lukket i et skall av bakket leire.

I tillegg til produksjon av verk trenger du ytterligere materialer og verktøy. Deres sett vil avhenge av den valgte teknologien.

Vi oppvarmer basen

Oppvarming av gulvet i første etasje er en flerfaset oppgave. For det er det nødvendig å nærme seg i en kompleks, flerfunksjons beskyttelse mot forkjølelse.

Oppvarming av sokkelen i konstruksjonsfasen

Så ofte oppstår problemer med temperaturregimet i første etasje på grunn av utilstrekkelig gjennomtenkt eller dårlig konstruksjon av sokkelen. Før du begynner å isolere gulvet, kontroller nøye hva som er under gulvet. Sokkelen kan isoleres både fra innsiden og utsiden.

Hovedårsakene til kaldt vær kan være:

Identifiserte sprekker og sprekker bør først ryddes av rusk, skjøre områder og etter at det lett kan forsegles med vanlig monteringskum.

Hvis i kjelleren eller uoppvarmet kjelleren i huset ditt er det ventilasjonsvinduer, så må de nødvendigvis lukkes ved tilnærming i den kalde perioden.

Kald i kjelleren av huset ditt kan overføres gjennom bakken. Hvis du på vinteren la merke til frysing av grunnarealer under taket i første etasje, kan dette medføre at byggherrer ikke tilstrekkelig dekker fundamentet. Oppbygging grunnlaget for det konstruerte huset er usannsynlig å fungere, men det er mulig å delvis løse dette problemet. På bakken i kjelleren eller sokkelen spres et lag med utvidet leire, og polystyrenskum er stablet, noe som effektivt hindrer at kulden trer ned fra bakken.

Backfilling kjelleren med utvidet leire

Vi oppvarmer gulvet i første etasje nedenfor

Etter å ha kontrollert tilstanden til kjelleren eller kjelleren, kan du fortsette til neste trinn - oppvarming gulvet i første etasje nedenfor. Det er mulig å gjøre dette hvis du har tilgang til kjelleren. I leilighetsbygninger medfører dette arbeidet visse problemer, siden du må nøyaktig beregne hvilke deler av gulvet som tilhører leiligheten din.

Vi limer skummet til taket

Velge en metode for oppvarming i første etasje

Hovedretningen for varmelekkasje fra lokalene i første etasje er fra toppen ned. I tillegg til varmelekkasje i nedre kjelleren er det også kondensering av vanndamp på overlappende overflate. De akkumulerende partiklene av fuktighet påvirker tilstanden til isolasjonen uansett, uansett hva den er. For å forhindre ødeleggelse av termisk isolator, er det nødvendig å velge et materiale som er ufølsomt for fuktighet.

Også forhindre opphopning av fuktighet kan et ekstra lag av dampsperre, tilstøtende direkte på det termiske isolasjonslaget. En polyetylenfilm med en tykkelse på 150 mikrometer er vanligvis en dampbarriere.

Teknologi av gulvbelegg isolasjon i første etasje fra under

  1. Rengjør bunnen av gulvet (vanligvis en enkel betongplate uten finish) fra rusk.
  2. I to strøk, dekk overleggeplaten med en primer.
  3. Påfør skumplater på undergulvet. Tykkelsen deres avhenger bare av ditt ønske. Skum er festet med spesial lim. Du kan også bruke lim til fliser.
  4. Spalter mellom skumplatene og mellom dem og veggene er forseglet med et monteringsskum.

Skummet varmeisolasjonsplater

Vi oppvarmer gulvet i første etasje ovenfra

Klatring fra bunnen til toppen, kan du begynne å isolere den øvre delen av gulvet i første etasje. På et øyeblikk vil vi legge merke til at enkelte oppvarmingsmetoder bare brukes for separate typer overlappinger. Så kan sement-sandskrapet ikke legges på tregulvet.

Vi varme tregulv

Mange liker tregulv. Det er i dem noe tradisjonelt, innenlands. Dessverre har tregulv ikke utmerket varmeisolasjon og lang levetid. Etter et tidsrom, er det nødvendig å revidere sin tilstand og om nødvendig reparere, kombinere reparasjonsarbeid med isolasjon.

Oppvarming av et tregulv

Oppvarming av et tregulv

  1. Først av alt gjennomfører vi en revisjon av tilstanden til gulvet. Vi fjerner den endelige gulvbelegget, fjern de etterfølgende lagene. Dette kan gjøres på et begrenset område av gulvet. For å vurdere tilstanden er det ikke nødvendig å demontere hele gulvet. Hvis du fortsatt bestemmer deg for å utføre store reparasjoner, trenger du en fullstendig demontering av gulvet, opp til lag. De gamle rotte elementene kastes hensynsløst.
  2. Etter at du har nådd basen - taket, begynner vi oppføring av gulvet igjen. Fra samme øyeblikk begynner arbeidet med isolasjon av gulvet i første etasje i en ny bygning.
  3. På gulvet er det "tøft gulv", legges trebjelker. Ved produksjonen er det en sterk trebjelke, tvangsbehandlet antiseptisk for å hindre forfall.

Forresten, isolasjon av gulvet kan vel være, og til og med må kombineres med arbeidet med å utjevne gulvet. Så når du legger loggen, ikke glem å kontrollere at loggenes overflater er helt horisontale.

  1. På grovt gulv i gapet mellom lags og direkte på dem er striper av polyetylenfilm, som vil fungere som en dampbarriere. Strimler av polyetylen stables overlappende hverandre ca 10 centimeter i 10. Du kan fikse filmen på tape eller fikse den med en konstruksjonsstifter.
  2. Lenger mellom er stengene tilpasset størrelsen på varmeisolatoren. Dette kan rulles ut av et rulle mineralull, plater laget av skummet polymer eller et spredt lag av utvidet leire. Laget av varmeisolatoren skal nå den øvre overflaten av loggen.
  1. På toppen av varmeisolasjonslaget kan dekkes igjen med en polyetylenfilm. Dermed beskytter vi varmeisolatoren mot kondensering av fuktighet fra kjelleren og fra fuktighetens gjennomtrengning fra rommet.
  2. Et ekstra vanntettlag er lagt med et ferdiggulv. Vanligvis kan tykke kryssfinerplater brukes til dette formålet.

Faser av arbeidet med isolasjon

Vi oppvarmer betonggulv

Også, som ved reparasjon og bygging av tregulv, kan prosessen med isolasjon av betonggulvet kombineres med utjevning.

Betonggulv kan isoleres ved hjelp av to grunnleggende teknologier - "tørt" og "vått" skred.

Dry screed er en ganske ny teknologi, og gjør det mulig å lage et grovt betonggulv for etterbehandling av gulvbelegg på kort tid.

Arter av arbeid på isolasjon av gulvet med en tørr skure

Oppvarmer gulvet med et tørt skikt

  1. Når du reparerer det gamle huset, bør du demontere eksisterende gulvbelegg og fjerne det. Når du bygger et nytt hus på dette stadiet, er det ikke nødvendig.
  2. Sjekk tilstanden til platen. Hvis den har sprekker, kan de sementeres med en sement-sandblanding. Spesielt forsiktig er det nødvendig å undersøke skjøtene mellom gulvets vegger. I nærvær av dype hulrom må de forsegles med monteringsskum.
  3. På den rengjorte og rengjorte overlappingen påføres et par primerlag.
  4. Etter at primeren tørker, legg en stripe av vanntetting (polyetylen) overlappende på overlappingen. Polyetylen bør gå til veggene i rommet til plasseringen av ferdig gulvbelegg.
  5. Bestem nivået for å løfte gulvet. Hvis du reparerer rommet, ikke glem at du har dører i rommet som du kanskje må gjenta etter å ha hevet gulvet. Nivået på det fremtidige gulvet er merket på veggene på rommet. Det er best å bruke lasernivået som projiserer strålen på veggene.
  6. På veggen av rommet legger du kompenserende tape. Dette er en stripe av skumpolymer som forhindrer skade på gulvet etter temperaturutvidelse. Høyden bør også være ikke mindre enn gulvets fremtidige høyde.
  1. Monter på gulvbjelker - segmenter av perforert metallprofil, som vil betegne den øvre grensen til oppvarmingsnivelleringsfyllingen. Det første fyret er plassert 10 centimeter fra romets yttervegg, og alle de etterfølgende er plassert på samme avstand, parallelt med hverandre, med en avstand på en og en halv meter. Den øvre delen av fyrene skal ligge i et ideelt horisontalt plan. Dette er et veldig viktig stadium av arbeidet. For å forene nivået, kan du bruke tråder strukket i rommet, eller det samme lasernivået. For å justere profilens høyde, er det stykker av kryssfinér, hardboard eller plast. Til overflaten av taket beacons-profiler er festet i små hauger av betong løsning.

Fyrtårn for tørre bånd

  1. I intervallene mellom beacons, er et varmeisolerende materiale dekket. Vanligvis er det leire av fine fraksjoner. Den fordeler fullstendig lasten fra ferdiggulvet og samtidig forhindrer varmelekkasje. Det løse materialet er nivellert av nivået på beacons med en lang metall stang-regel.

Leveling fylling av fyrtårn

  1. På den utvidede leire er det mulig å plassere et andre lag av polyetylen.
  2. Etter opprettelsen av et lag av oppvarming og utjevning, er det mulig å montere et etterbehandlingsark av fuktresistent gipsplater, tykk kryssfinér, eller "Superpol", som har en lås for å feste komponentdelene mellom seg.

Legging av ferdiggulv

  1. Det ferdige etterbehandlingsgulvet legges på ferdig ferdiggulv. Mellom ferdiggulv og overflatebelegg kan du også plassere et annet isolasjonslag, for eksempel korkplater.

Arbeidets rekkefølge på isolasjon og utjevning av gulvet i første etasje ved hjelp av teknologien for "våt" skred er beskrevet i en egen artikkel.

Du kan også se en opplæringsvideooppgave som forklarer hvordan du effektivt kan isolere gulvet i første etasje.

Video - Oppvarming i første etasje

Nikolay Strelkovsky Editor-in-Chief

Forfatteren av publikasjonen 10/18/2014

Liker du artikkelen?
Lagre for ikke å miste!

Oppvarming av første etasje

Gulvvarme i huset i første etasje er et must. Det kan ikke være den eneste løsningen for å oppnå full komfort i hjemmet, og er ofte bare en scene fra en hel pakke tiltak for å gi varme. Vi snakker om isolasjon av vegger, tak, inngangspaneler og vindusåpninger. Men det mest logiske er å begynne å ta vare på termisk isolasjon når alt kommer fra gulvet. I artikkelen vil vi snakke om isolasjonen av gulvet overlappingen i første etasje.


Gulvmontering av første etasje

For det første er det nødvendig å bestemme hvilken type et bredt spekter av materialer som skal brukes til å isolere overflaten. De mest populære for øyeblikket er:

  • polystyrenskum;
  • utvidet polystyren;
  • tørrskred fra utvidet leire;
  • glassull;
  • mineralull.

De avviker ikke bare i verdi, men også i en rekke egenskaper som bør vurderes mer detaljert. Siden noen av de foreslåtte materialene har en lignende opprinnelse eller forveksles med analoger, vil en komparativ karakteristikk bidra til å bestemme valget.

Gulvisolering i første etasje

Polyfoam eller utvidet polystyren

  • Hvis vi snakker om slægtskap, så eksisterer disse to varmeovner. Polyfoam er noe eldre, polystyrenskum - dette er heller sin forbedrede versjon.
  • Forskjeller begynner allerede på produksjonsstadiet. Som råmateriale brukes polystyrengranuler. For produksjon av skumplast, behandles de med en strøm av varm luft, og de ekspanderer når de blir med. Et produkt med en porøs struktur dannes. Ekstruderingsmetoden er mer progressiv, og som resultat av bruken smelter granulene av utgangsmaterialet. Utgangen er et materiale med en enkelt struktur, mer tett enn det ovenfor beskrevne eksemplet. Samtidig beholdes den cellulære strukturen som fremmer oppbevaring av varmen, i den.
  • Skummet polystyren er sterkere enn sin "kollega" ved en bøyning på 5-6 ganger, og det vil ikke smuldre hvis miljøforholdene endres. I tillegg absorberer polystyrenskum fukt verre, og takket være en forbedret tetthetsindeks absorberer det mye mer effektivt støy.
  • Begge materialer er lavnøkkel og giftfri (forutsatt at høykvalitets byggeprodukter er brukt fra anerkjente merker). De er heller ikke utsatt for rot og mold er ikke dannet på dem. Ildfaste indekser er gode for begge produktene. Polyfoam er mer hensiktsmessig å bruke til oppvarming av gulv i de rom hvor det antas en liten patency, og overflaten vil ikke oppleve ekstra belastninger fra for eksempel massive møbler. Det er også egnet for de som ønsker å spare penger. Men som følge av ovennevnte tekniske egenskaper, er dette ønske ikke alltid hensiktsmessig.

Glassull eller mineralull

En annen utfordring er valget mellom glassull og mineralull.

  • Sistnevnte har meget imponerende indikatorer på brannmotstand, så det brukes oftest ved oppvarming av tregulv. Den naturlige uorganiske opprinnelsen til steinull gir rett til å snakke om sin økologiske kompatibilitet, motstand mot multiplikasjon av patogene mikroorganismer.
  • De isolerende egenskapene til mineralull blir ikke stilt spørsmålstegn ved. Det er trygt å si at bruken av dette vil redusere kostnadene ved oppvarming av lokalene. Det vil også gi et høyt nivå av lydisolasjon. Alle disse fantastiske egenskapene vil ikke "fungere", hvis lagringsteknologien blir forstyrret når gulvet er isolert. Derfor gir du preferanse til rockwool, bør du følge installasjonsretningslinjene nøye.
  • Steklovata er forskjellig ved at den produseres på grunnlag av knust glass, som faktisk ikke har noe relatert forhold til mineralull. I dette tilfellet mister den det (ubetydelig) i indikatoren for termisk isolasjon og til og med i muligheten til å krympe seg med tiden. I tillegg er det ikke så behagelig å jobbe med den som med rockwool på grunn av dannelsen av et grunt "glass" støv som irriterer luftveiene og hendene hvis de ikke er beskyttet. Men det vil koste mye mindre enn en "stein" analog. Så de som er enige om å oppleve ubehag når de legger materialet og ønsker å spare penger, kan velge glasull.

Fordeler med utvidet leire

  • Dette porøse materialet er faktisk leire. Den er dannet av granuler og behandlet ved høye temperaturer. Resultatet er en utmerket isolasjon, dens flytbarhet gjør det enkelt å fylle alle hulrommene.

Det er bra for flere indikatorer:

  • holdbarhet;
  • økologisk kompatibilitet;
  • brannmotstand;
  • fullstendig motstand mot utvikling av mikroorganismer, forårsaker ingen interesse for gnagere og andre skadedyr;
  • fordi.
  • På grunn av den porøse strukturen er det et ganske lett materiale, men dårligere enn denne indikatoren til andre varmeovner, inkludert de som tidligere er beskrevet. Og også den utvidede leire skaper et utmerket lag, noe som bidrar til naturlig ventilasjon. Lydisolasjon, oppnådd etter bruk, regnes som en av de beste.
  • Mot den utvidede leiren kan man også spille tykkelsen på gulvet i første etasje, som for organisering av et kvalitetslag av termisk isolasjon vil kreve en betydelig margin i høyden. Minimum anbefalt lag av polstring er 20 cm, og optimum er 40 cm. Glem ikke å legge til høyden på skrapet.

Tips for å velge en varmeapparat i første etasje

  • For endelig å bestemme materialet for isolasjon, må du ta hensyn til mange faktorer. På bekostning av glassull, polystyren eller utvidet leire - de mest foretrukne alternativene.
  • Hvis tiden er avgjørende, er styrofoam lettere å pakke og raskere.
  • Når det er nødvendig å utføre prosedyren i samsvar med alle regler og krav til brannsikkerhet, vil mineralull være det beste valget.
  • Og fortsatt det viktige kriteriet var, og det er behov og muligheter for eierne av strukturen. Men uansett, uavhengig av å utføre alt arbeidet under makten til noen hjemmester.

Termisk isolasjon i første etasje med claydite

Utvidet leire veldig god fuktighet. Dette er den største ulempen ved dette materialet. Derfor blir byggingen av et høyverdig vanntettingslag det første og svært høyt prioriterte stadiet. Deretter skal en detaljert gulvkake i første etasje bli malt med claydite.

  • Beskyttelse mot fuktighet. Det vanligste materialet som brukes til dette formålet er polyetylenfilm. Du må ta mest holdbare. Naturligvis kan man ikke gjøre det, så leddene er forsiktig limt med tape. Beregning ved oppretting av et vanntettingsark bør være med vekt på at kantene skal overstige nivået på hele prospektet sammen med screed. Ekstra centimeter etter kan bli beskåret.
  • Vi forbereder en varmeapparat. Den maksimale effekten blir lettere ved fremstilling av en blanding fra et materiale med forskjellige fraksjoner. Bruken av utvidet leire i størrelser fra 5 til 20 mm vil tjene den beste fordeling av granuler og vil skape et mer akseptabelt grunnlag for adhesjon til betong.
  • Fyr. Deres eksponering er nødvendig for å skape en perfekt flat overflate uten endringer og bakker. Den første ligger noen få centimeter unna veggene. Fiksering utføres på små hauger av tilstrekkelig tykk sementmørtel. Ytterligere beacons er plassert parallelt med den første. Avstanden til innstillingen tilsvarer lengden på regelen. Det vil bli brukt til etterfølgende utjevning av skredet. Vanligvis brukes en metallprofil til styrene. Hvis gulvisoleringen med etterfølgende helling utføres selv for første gang, er det bedre å ikke "spare" på antall fyrtårn.
  • Preparert keramitt kan sovne. Den er jevnt fordelt og litt komprimert. Nivået på fylling trenger konstant overvåking for å unngå forstyrrelser. Da vil det være nødvendig å impregnere baksiden med en løsning av flytende sement. Denne "sementmelken" vil gi styrke til isolasjonslaget og tillate det å forbli i sin opprinnelige posisjon med ytterligere helling. Det forsterkende laget av metallnettverket vil være det siste trinnet på dette stadiet.
  • Fyllingen. Den forberedte løsningen er jevnt fordelt fra veggen i henhold til beaconnivået. Glatt ut regelen. Så flytt deg gradvis til inngangen til rommet.
  • Du kan gå på screed ikke tidligere enn 7 dager, og fullstendig belegget herdes og vil være klar for ferdigbehandling i løpet av en måned. Mens tørkeprosessen pågår, for å unngå sprekker, bør du fuktige det fremtidige gulvet med vann. Kontroller at "beredskap" kan gjøres på denne måten: Legg nakken ned i glassburet. Hvis kondensat dannes på veggene, betyr det at det er mye fuktighet i gulvet, og det er for tidlig å begynne å legge på overflaten.
  • Som et resultat blir det oppnådd en holdbar og varm overflate på hvilken fliser, laminat eller andre typer gulvbelegg ideelt sett ser ut.

Som et alternativ kan du vurdere en "tørr" screed ved hjelp av claydite og gipsfiber (gipsfiberark).

  • Skaper et vanntett lag. Den er montert, som i det første tilfellet overlappes leddene med ca 20 cm, og veggene er laget i en margin på 6-7 cm.
  • Gjennom romets omkrets er stengene mellom filmen og veggen stengt med spjeldbånd.
  • Beacons er utsatt.
  • I porsjoner er utvidet leire fylt. Den er utjevnet og litt komprimert. Etter dette er det nødvendig å sjekke korrespondansen av høyden i henhold til nivået. Denne operasjonen utføres gradvis i separate seksjoner. Så snart et stykke gulv er tilberedt, er det umiddelbart dekket med et gipsplank. Det er spredt i to lag, limer sammen og i tillegg fester skruene.
  • Sømmene i leddene til GVL shpatlyuyut, du kan gå langs dem med et lag av bitumen vanntett.
  • Rester av filmen og spjeldbåndet er avskåret, basen er klar for etterbehandling.

Oppvarming av første etasje med mineral eller glassull

Hvis ønsket om å isolere gulvet allerede har dukket opp under driften av bygningen, må du først bli kvitt det gamle gulvmaterialet. Når det er en demontering av brettene, som i fremtiden er planlagt å bli returnert til området, kan de nummereres for enkel montering.

  • Tilstanden til loggene og tøffe gulv vurderes. Hvis det er rotte elementer, blir det første arbeidet som gjøres for å erstatte dem.
  • Impregnering. Det er bedre å velge polyetylen med en tetthet på 100 μm eller høyere. Han lagt overlappende med 10 cm bør bli stående nær høyden av veggene i sitt lager, også om 10 -. 15 cm Hvis vannet tabellen er for nær overflaten, som en dampsperre er å foretrekke å velge en taktekking eller asfalt..
  • Mellom lagene på ferdig gulvet er valgt isolasjon. Overfra er det dekket med et annet lag av isolasjonsmateriale.
  • Med en tykkelse på 2 cm er et gitter konstruert. Dens funksjon er å gi et luftgap.
  • En ny etasje blir bygget eller gamle planker blir satt sammen igjen.

Hvis det er nødvendig å isolere betonggulvet i første etasje med mineralull, legges lags først inn. Dampisolasjonsfilmer er ikke påkrevd.

Oppvarmer gulvet i huset med polystyren

  • Laget av vanntetting er opprettet ved hjelp av tidligere beskrevne teknologier. Det antas at det er spredt over en justert overflate.
  • Over er det beacons.
  • Sementplaten utføres. Tykkelsen er 4 cm.
  • På den i en sjakkbrett rekkefølge plater av en skumplast som er tett innstilt på hverandre, er montert. Etter det er skredet igjen alene for et par dager.
  • Etter at det første laget har tørket, utføres en endelig screed. Bakkenene til den er festet til varmeapparatets plater. Tykkelsen av sementlaget er 70 mm. Fyllingen utføres ved hjelp av et forsterkende nett. Etter å ha nivellering og tørking av mørtel, er gulvet klare for etterbehandling med noe belegg.

Korrekt påføring av ekstruderende polystyren i skapelsen av termisk isolasjon av gulvet

  • Hvis stikkskummet legges inn i stokken, skal de være plassert fra hverandre i en avstand på 60 cm.
  • I utgangspunktet legges vanntettingslaget, og deretter mellom lags er varmeapparatet tett lagt.
  • Ved hjelp av en konstruksjonsstifter er et annet lag av dampspærre festet over toppen. På toppen av denne puffede konstruksjonen er dekket med laken av kryssfiner eller brett.
  • En uunnværlig tilstand er ventilasjonsgapet, som ligger rundt omkretsen av hele rommet (ca. 0,5 cm). Det vil ikke være synlig etter installasjon av skjørtbrettene.
  • Ved den relativt høye pris av ekspandert polystyren skaper en høy kvalitet og en varm lag, som vil vare i lang tid. Men eksperter anbefaler å vurdere følgende punkter når du bruker det: hvis polystyren brukes til isolasjon av gulv, deretter samme prosedyre med taket og veggene er bedre å foretrekker en mer "pustende" materiale, for ikke å skape et hjem drivhus.

Oppvarming av gulvet i leiligheten i første etasje

Leiligheten i første etasje er plassert over kjelleren, hvorfra gjennom betongplaten overlappende fuktighet og kulde trener inn i rommet. Høy luftfuktighet, ubehagelig lukt, sopp og ubehagelig temperatur på gulvet - leietakere møter disse problemene hver dag til de bestemmer seg for å utføre termisk isolasjon av betongfundamentet.

Vi oppvarmer gulvet fra kjelleren

Ekstern termisk isolasjon av basen er alltid effektiv og tar ikke plass i rommet. I den generelle kjelleren er det nødvendig å bestemme og markere området på leiligheten din. Ved fuktighetsbestandig isolasjon benyttes fuktresistent isolasjon - polystyrenskum eller polystyrenskum. Tykkelsen på laget for varme områder er 10 cm, for kalde områder - 15 cm. Termisk isolasjon utføres i henhold til følgende teknologi:

  1. Plater av skum med lim er festet til betongloftet i kjelleren.
  2. For å beskytte materialet fra gnagere, legges et metallnett og festes med plastdugg.
  3. Polyfoam er dekket med en polyetylenfilm for vanntetting. Som erstatning for fuktresistent lerret, som kan bli skadet, må du bruke bitumenbeleggisolasjon.

Du kan bruke mineralull som varmeapparat, men det vil ta mer innsats. Under materialet er det nødvendig å fikse lathing, legge vanntett og dekke det med fuktsikker kryssfiner.

Termisk isolasjon av betonggulv

Kampen med gjennomtrengende forkjølelse begynner med avsluttingen av sprekkene i basen. For å forsegle dem, brukes et monteringsskum, det kan brukes til å behandle skjøten mellom gulvet og veggen. For å bli kvitt fuktighet i en leilighet i første etasje, tillater det en grundig vanntetting. Ved høy luftfuktighet er hele gulvområdet dekket av smøring eller penetrerende isolasjon. Etter det er en polyetylenfilm med en tykkelse på 200 mikrometer tykk. Kantene på lerretet skal gå til veggene i en høyde på 15-20 cm. Filmen er stablet med overlapping av tilstøtende striper på 10-15 cm, leddene er forseglet med byggbånd.

Utfør gulvisolering i leiligheten på flere måter:

  • skred av betong med isolasjonsadditiver: sagflis, utvidet leire, perlitt;
  • legging av varmeisolerende materiale på lags;
  • tørrgjøring under gipsfiberpaneler;
  • bruk av utvidede polystyrenplater til betong;
  • system varmt gulv.

Arbolitt eller lettbetong fra en blanding av sement og trefyllstoffer er et rimelig og høyverdig alternativ for termisk isolasjon. Det er miljøvennlig, holdbart, ikke-brennbart og slitesterkt. Mangel på isolasjon - en gulvforhøyelse på 10 cm og en tørketid på opptil 25 dager.

Ved å bruke en logg for termisk isolasjon vil også hevet basen. Arbeidet utføres i etapper:

  1. Trebjelker legges på laget av vanntetting i 50 cm trinn.
  2. Mellom styrene plasseres isolasjonsutvidet leire i et lag på 10-12 cm eller mineralulltykkelse på 10 cm. Materialet er lagt tett, gapet mellom det og lagret er fylt med monteringsskum.
  3. Polyetylenfilmen for dampbarriereisolasjon blåses. Det er festet med klemmer, leddene limes med et spesielt tape.
  4. Rå gulvet er laget av brett eller kryssfiner.

Isoler betonggulvet på kort tid, slik at det blir tørrskikt som ikke tar tid å tørke ut. På spredt vanntettgjennomgang helles keramikk, fin brøkdel eller sand, blir steinen fordelt jevnt på 5 cm og komprimert. Varmeapparatet er lagt fuktresistent gipsplank i to rader eller spesialpaneler "superpol KNAUF", hvis tykkelse er 20 mm. Arkene limes og behandles med kitt. Belegget har lav termisk ledningsevne, beskytter mot støy og fuktighet, er trygt og krever ikke våte prosesser. På gipsovolokno parkett, linoleum, laminat.

Styrofoam har høy tetthet og styrke, det blir en pålitelig og varm base for gulvet. Plater plasseres i enighet, slik at lasten fordeles jevnt. Leddene mellom dem er lukket med et monteringsskum. Materialet er dekket med et metallforsterkende nett og helles med et lag av sementskrap 5 cm høyt.

Enheten i det varme gulvsystemet er det beste alternativet for en leilighet i første etasje, det vil avlaste fuktighetskammeret og til enhver tid øke temperaturen på belegget til et komfortabelt nivå.

Her kan du arrangere vann, elektrisk eller filmgulv. Systemet er lagt på basen, isolert med utvidet polystyren. Under den ligger et foliemateriale som reflekterer siden inn i rommet. Vann- og el-kabelgulvet legges under screed, og den infrarøde filmgulvet er plassert under overflaten.

Enn å varme et tregulv?

Tre har en lavere varmeledningsevne enn betong, men i første etasje virker det kaldt og fuktig. Før du fjerner brettene i belegget, må du velge en varmeapparat. Basalt bomullsull er vanligvis tatt, den opprettholder perfekt varme, absorberer støy, rotner ikke og tiltrekker seg ikke gnagere, det er trygt i tilfelle brann.

Utvidet leire er et naturlig løs materiale for termisk isolasjon, den har en liten vekt og en rimelig pris, som raskt og enkelt passer. Du kan bruke utvidet polystyren, materialet er holdbart, motstandsdyktig mot fuktighet og stress, men kostnaden er høyere enn andre varmeovner.

Prosessen med isolasjon av en trebase består av flere faser:

  1. Brettene blir fjernet og inspisert, hvis de er i god stand, blir de returnert til deres sted etter at alle verkene er ferdigstilt.
  2. Bearbeiding av trelag er utført med et antiseptisk middel.
  3. Lerret av vanntetting drypper med tilnærming til veggene opptil 20 cm. Alle loggene blir til en film.
  4. Mellom stengene er den rulle basaltiske bomullsullen tett lagt ut eller den utvidede leire helles. Isolasjonshøyden når ikke toppens topp med 5 mm.
  5. Det leggede materialet er dekket med en dampbarrierefilm, slik at fuktighet ikke kommer på den fra leiligheten.
  6. Shpunovannye styrene er spikret til lags.

Riktig å ha utført varme og en vanntetting av et gulv i en leilighet, vil du i lang tid glemme fuktighet og forkjølelse.

Vi gjør isolasjonen av gulvet fra bakken

Isolasjonen av gulvet, som skiller dekket fra bakken, eller mer presist, beskytter mot skadelige effekter (fuktighet, kulde) er inkludert i listen over nødvendige prosedyrer for gulvinstallasjon. Teknikken for å bygge gulvet avhenger av formålet med bygningen der konstruksjonen foregår, samt på andre faktorer (fuktighet, temperaturvariasjoner, støynivå i nærheten). Gulvisolering av høy kvalitet kan ikke bare øke komfortnivået i huset, men sørge også for sikkerhet for byggematerialer fra eksterne faktorer.

Gulv er en konstruksjon som har flere lag, og deres isolasjon kan også ha slike lag:

  • Termisk isolasjon;
  • lydisolering;
  • Impregnering.

Vanntetting av grunnvann

Det første og viktigste nivået er gulv vanntett. Det er laget for å beskytte betongfundamentet, og også for å forhindre rotting av trematerialene som ble brukt under byggingen av huset. Den økte luftfuktigheten påvirker ikke bare etterbehandling, men også selve konstruksjonen av huset, noe som øker tiden som huset blir uegnet for livet. Disse problemene og bidra til å unngå skikkelig gjort vanntettingsgrunnlag.

Isolasjonen av gulvet ved belegging utføres ved hjelp av epoxyharpiks, syntetisk eller bituminøs mastikk.

Roll eller overlappende type isolasjon innebærer bruk av takfilt, takfilt og andre komponenter med høy pålitelighet.

For en hvilken som helst type vanntetting, vil arbeidsordren være som følger:

  • Substrate forberedelse;
  • Legge av isolasjonskomponenten;
  • Tetning av vanntetting.

Hva vil være nødvendig under vanntettingsprosessen?

I prosessen med å lage en belegg type isolasjon, brukes bitumen-polymer eller bitumen-gummi mastikk. De inneholder oksidert bitumen, kombinert med et organisk løsningsmiddel og et sterkt fyllstoff (gummikrem, mykner, latex). Mastic kan brukes uten spesielle forberedende tiltak. det er preget av god vedheft.

Vanntetting av smøringstypen utføres med minst utgifter av tid og krefter. Mastikk er påført fra veggen, som er motsatt døren, i prosessen er materialet utjevnet med en spatel eller en bred børste. Alle komponenter av denne typen isolasjon er utformet direkte på emballasjen, det indikerer metoden for påføring, det optimale antall lag og tiden der mastikken tørker.

Komponenter for vanntett oklechnogo type selges i form av ruller. Sammensetningen inneholder en base av bitumen, polymerer, forsterkende glassfiber og polyester. De viktigste fordelene ved denne typen isolasjon er: Enkel installasjon, muligheten for å bruke gulvet umiddelbart etter liming, høy styrke, i tillegg er gulvet også lydisolert.

Men oklechnaya-isolasjon har sine ulemper: Basen for liming må være nøye forberedt. I et lukket rom vil det ikke lukte en meget behagelig lukt av bitumen, gulvets høyde etter at skruen vil vokse litt over 50 mm.

Termisk isolasjon av gulvets underlag

Også viktig er termisk isolasjon av gulvet. Riktig isolert gulvbase vil bidra til å redusere kostnadene ved oppvarming av rommet, og dermed forbedre levekårene i huset. For bygninger av moderne type er isolasjonen av gulvet veldig viktig, i dem går kaldet gjennom de horisontale flatene mye mer aktivt enn gjennom de vertikale. Termisk isolasjon er spesielt relevant når rommet ligger ved krysset mellom forskjellige mikroklimater (loft og rom, kjeller og rom). Også kvaliteten isolasjon av gulvet, og spesielt i første etasje, vil ikke være overflødig selv om vinteren, for å hindre utgivelsen av varm luft fra huset, og dermed redusere kostnadene for energi og oppvarming.

Enhver konstruksjonsmateriale i en viss grad overfører varme, men på grunn av forskjellig materiale hvor varmeoverføringslaget også varieres. For å maksimere kvaliteten av den termiske regime, blir isolerende sjikt benyttet i boligområder, som praktisk talt ikke absorberer varme, dvs. at den er fullstendig overført inn i rommet. Til dags dato er byggematerialemarkedet representert av en rekke typer belegg som forhindrer tap av varme. De mest populære materialene med lignende funksjoner er polystyrenskum, utvidet polyetylen, polystyrenbetong og mineralull.

Prosessen med isolasjon

Men for å isolere gulvet er det ikke nok bare å ta det dyreste materialet. Ved stadium av fremstillingsprosedyrer trenger å ta hensyn til faktorer, det materialet som gjorde gulvet (betong eller tre), er den maksimale høyde av det termiske isolasjonslag og forholdene i rommet (lasten horisontalt på gulvet, fuktighetsmiljø, er den gjennomsnittlige temperatur).

Oppvarming av gulvene i første etasje leilighet

Leiligheter ligger i første etasje, sterkere enn andre leiligheter i huset, lider av fuktighet og kulde. Dette skyldes direkte kontakt med gulvbelegget med platene, som skiller leiligheten fra uoppvarmet kjeller. Som et resultat er gulvet kaldere hele tiden enn luften i leiligheten, og hvis dette ikke er så merkbart om sommeren, så om vinteren vil et slikt kjølig gulv avkjøle hele rommet, i tillegg til å provosere utseendet av fuktighet.

Derfor, for normal temperatur på gulvbelegget, er det nødvendig å isolere gulv. Du kan gjøre dette ved å reparere deg selv eller bruke innarbeidede arbeidere. Essensen av gulvets isolasjon er å legge et lag eller flere lag isolasjon på gulvet mellom kjelleren og leiligheten. I tillegg er dampisolering nødvendig, fordi kondensatets utseende på grunn av temperaturforskjellen er uunngåelig, og fuktighet virker negativt på isolasjonsmaterialene. Deretter skal vi vurdere ulike alternativer for isolasjon, isolasjon, fortell om materialer, priser og forklare hvordan du gjør alt arbeidet selv.

Typer av varmeovner

ekspandert polystyren

Styrofoam, bedre kjent som polystyren eller en modifisert penopleksampolymer, har gode varmeisolasjonsegenskaper, lav vekt og er lett å bruke. Det er også ekstrudert polystyrenskum. Dens forskjell fra vanlig, i vannmotstand. Hvis vanlig utvidet polystyren kan absorbere en viss mengde væske og deformeres på grunn av dette under temperaturendringer, er det mer teknologiske utseendet nesten helt vanntett. Den eneste ulempen ved utvidet polystyren er dens antennelighet.

Utvidet leire

Dette løsematerialet har en attraktiv pris og er universell. Kan brukes med tørr gulvbelegg eller blandet med sementmørtel. Også med hjelpen kan du ordne en flytende skred med egne hender.


I kontrast til utvidet leire, krever polystyrenbetong et mye mindre lag, for å skape akseptable isolasjonsegenskaper. På den er det mulig å dekke nesten alt, inkludert en flis. I tillegg har den gode støyisolerende egenskaper. Lær mer om dette materialet fra videoen


Mineralull, så vel som glassull - en av de mest populære isolasjonene, som er laget i form av fliser eller ruller. Fordelene er varmeisolasjonsegenskaper, rimelig pris og dampabsorpsjon. Ulempene er en helsefareforbindelse. Når du installerer med egne hender, bør du bruke åndedrettsvern og unngå å komme på åpne deler av kroppen. Derfor trenger mineralull og glassull forsiktig isolasjon slik at støv ikke trenger inn i rommene.


Kork er trolig den dyreste i vår liste. Det er miljøvennlig, slitesterk og fuktresistent. Den kan brukes til etterbehandling, i tillegg til isolasjonsegenskapene, det ser vakkert ut som en ferdig jakke. Blant manglene kan man merke ustabiliteten til kutt og andre mekaniske skader.


Det er laget på basis av cellulose, noe som betyr at det er miljøvennlig og ikke farlig for helse. Den har høye varme- og lydisolasjonsegenskaper, men tolererer ikke fuktighet. Derfor brukes den i områder der det ikke er fare for kontakt med fuktighet. Mer om meritter og nedbrytninger av økologiske verktøy, se i videoen


Det er flytende utvidet polystyren, av alle fordelene vi har diskutert ovenfor. Fordelaktig forskjell på flytende form av slikt materiale, i evnen til å trenge inn i de mest ubeleilige stedene.


Muligheten til å installere et varmt gulv blir stadig mer populært. Det motvirker bare kostnaden. Det er flere variasjoner:

  • vann;
  • Electric;
  • Infrarød.

Vannoppvarmet gulv varmes ved kommunikasjon med varmt vann under grov etasje. Elektrisk gulvvarme er også installert og oppvarmet ved å konvertere elektrisitet til varme. Infrarød er den mest moderne, enkleste versjonen, og den kan legges med egne hender uten å involvere spesialister. Tynne elementer i det varme gulvet legges under ferdiggulvet. Bare denne typen sex kan realiseres med egne hender, uten spesielle ferdigheter.

Oppvarming fra kjelleren

Hvis leiligheten ligger i første etasje, så er det mest sannsynlig under kjelleren. Den åpenbare løsningen for gulvisolering, vil være å reparere fra kjelleren, hvis det ikke er behov for å reparere inne i leiligheten. I dette tilfellet er det store pluss at gulvet i leiligheten ikke stiger, og også hvis reparasjonen allerede er ferdig, trenger du ikke å åpne gulvet og omforme på nytt. Når isolert fra kjelleren, er det ikke behov for en fin finish, noe som gjør det mulig å utføre arbeidet selv, selv en uerfaren byggherre.

Som materiale for slike reparasjoner passer best for vanlig polystyren eller mineralull, men montering av egne hender er mer arbeidskrevende og prisen er høyere.

  • I første etappe må du finne gulvplaner, og merker, langs omkretsen av leiligheten din. Det er bedre å gjøre med en lager, slik at området for oppvarming noen få centimeter ville gå utover veggene.
  • Deretter utføre en undersøkelse av kjellerveggene. Sannsynligvis vil de ha sprekker og chips, og kanskje hull. De skal forsegles med sementmørtel eller et enkelt monteringsskum.
  • Det første laget limes til dampspjeldet, for å bygge lim eller tape. Polyetylen brukes som et materiale. Leddene må tettes tett med tape.
  • Deretter er en ramme laget av tre- eller aluminiumprofiler for å fikse varmeren.
  • Deretter legges isolasjonsmaterialet. Hvis du bruker utvidet polystyren, er det montert i en ramme og festet med spesielle dowels med et bredt plasthodel som vist på bildet nedenfor.
Ordning fastgjøring skum plast dowels

Hvis valget ditt falt på mineralull, er taket installert logger fra baren, med et trinn mindre enn 5 cm mindre enn isolasjonens bredde, slik at vannet går tettere. Det siste trinnet i reparasjonen vil installeres over isolasjonen på loggene på kryssfinerarkene, for større pålitelighet.

Oppvarming i leiligheten

Før du reparerer gulvets isolasjon med egne hender, må du beregne hvor høy det er mulig å heve gulvene. Jo høyere - de tykkere isolasjonslagene kan brukes.

  • Hvis arbeidet skal foregå i rommet etter reparasjon, er det først å demontere basen.
  • Etter å ha fjernet alle gulvbelegg, er det gjort en grundig undersøkelse av basisplaten, for sprekker, chips og hull. Hvis de er funnet, er de sementert med sementmørtel, eller med en ferdig morter for reparasjon. Etter herding anbefales det at overflaten behandles med silting, en spesiell styrkeimpregnering.
  • Det neste trinnet er vanntetting. Dette laget består av polyetylen eller en spesiell primer, som har vannavvisende egenskaper.
  • Et lag av takmateriale legges på toppen av dampspærren, strålen legges på den, og logger er allerede lagt på strålen. Hele strukturen er festet til betongbasen. Detaljert beskrivelse av enheten lagrer med egne hender på video

Videre, så langt som høyden tillater, er løs isolasjon fylt. Du kan bruke tørr claydite eller legge til en flytende sementløsning. Den sovner på en slik måte at det fortsatt er et sted å legge det siste laget av termisk isolasjon, for å legge det grove og rene gulvet. Det kan være plater eller ruller av mineralull, eller utvidet polystyren. I tillegg er en skumisolering også egnet. Deretter et annet lag av dampbarriere. Polyetylen er festet til lags ved hjelp av stifter.

Og det siste trinnet er enheten av det svarte gulvet. Kryssfiner eller brett kan brukes som materiale. Dette avhenger av valg av ferdiggulv.

  • Sosiale Nettverk